Thursday, November 12, 2009

The Best Foods to Eat After a Workout

sesame seeds

Getting plenty of exercise can leave your body ravenous. However, loading up on the wrong foods can undo much of the good that your workout has done. Thankfully, there are many amazing foods that are able to help your body take full advantage of all your hard work. Here are the best foods to eat after a workout.

Almonds

Almonds are the perfect snack to refuel with after a workout because they're high in leucine. Leucine is an essential amino acid that is will give you energy and help to keep your muscle protein from breaking down so that your body can take full advantage of the exercise you do.

Brown Rice

Brown rice is high in good carbohydrates. These carbs will keep your body from having to draw on its stores of glycogen to refuel your body. Try eating brown rice will some healthy steamed vegetables. Brown rice also contains manganese and selenium .

Tuna

Tuna is a great way to feed your body the lean protein in needs to help your body become more toned.Light canned tuna is also extremely low in calories, so you won't risk consuming as many calories as you have burned. Tuna is also a great source of niacin, selenium, vitamin B6, potassium, and thiamin.

Avocado

Avocado is full of good monounsaturated fats. Eating it after you've burned away fat exercising is a great way to replace bad fats with better ones. Avocado is also rich in nutrients like vitamin K, fiber, potassium, vitamin B6, vitamin C, folate and copper.

Salmon

Not only does salmon pack in a healthy dose of protein, but it's also full of omega-3 fatty acids, which can help to increase the amount of fat calories that your body can burn in a day. Vegetarian foods high in omega-3s include walnuts, spinach, and Brussels sprouts.

Yogurt

Yogurt is a very good source of glutamine, which your body drains after working out. Studies have also linked eating low-fat yogurt with weight loss. A few other reasons to chow down on yogurt include iodine, calcium, protein, phosphorus, and vitamin B2.

Sesame Seeds

Sesame seeds are full of an essential amino acid called isoleucine, which has been shown to help increase muscle protein. After exercising, your body will be running low on isoleucine, so taking a bag of sesame seeds with you to your gym to refuel is a great idea.

Blueberries

Berries are a great way to give your body a little dose of the good carbohydrates it needs. Blueberries are a particularly great pick since they're able to replenish so many of the nutrients drained from your body. From vitamin C and manganese to fiber and vitamin E, blueberries have it all.

23 comments:

Bob November 8, 2010 at 11:11 PM  

Thanks for an informative article

Anonymous,  March 26, 2013 at 6:00 PM  

Write more, thats all I have to say. Literally, it seems as though you relied on the video to make your
point. You definitely know what youre talking about, why throw away your intelligence on just posting
videos to your site when you could be giving us something enlightening
to read?

Here is my web page; Klean Slim Colon Cleanse - kleanslim.net

Anonymous,  April 9, 2013 at 5:06 AM  

Great article. I am facing many of these issues as well..

Feel free to surf to my web site workouts for vertical leap

Anonymous,  April 12, 2013 at 2:01 AM  

hi!,I like your writing very so much! proportion we be in contact more approximately your article on
AOL? I need an expert on this house to resolve my problem.
Maybe that's you! Having a look forward to look you.

Here is my web page - exercises to improve vertical

Anonymous,  April 14, 2013 at 2:46 AM  

I am genuinely thankful to the owner of this web site who has shared this wonderful article at at this
place.

my web site ... breakfast york pa

Anonymous,  April 14, 2013 at 7:35 AM  

Right away I am going to do my breakfast, later than having my breakfast coming yet again to read additional news.


Feel free to visit my site :: workouts to jump higher

Anonymous,  April 14, 2013 at 12:08 PM  

For most recent information you have to visit the web
and on world-wide-web I found this web page as a best web site for hottest updates.



Feel free to visit my web site - exercises to improve vertical jump

Anonymous,  April 15, 2013 at 8:59 AM  

I do not know if it's just me or if perhaps everybody else encountering problems with your site. It appears as if some of the written text on your content are running off the screen. Can somebody else please comment and let me know if this is happening to them too? This may be a issue with my web browser because I've had
this happen previously. Cheers

Stop by my website ... exercises to increase vertical leap

Anonymous,  April 21, 2013 at 8:01 PM  

Greetings from California! I'm bored at work so I decided to browse your blog on my iphone during lunch break. I really like the information you present here and can't wait to take a look when I get home.
I'm surprised at how quick your blog loaded on my cell phone .. I'm not even
using WIFI, just 3G .. Anyhow, very good site!

My site: denny's free breakfast 2011

Anonymous,  May 4, 2013 at 2:38 AM  

Greate pieces. Keep posting such kind of info on your page.

Im really impressed by your blog.
Hey there, You've performed a great job. I'll definitely digg
it and for my part recommend to my friends.

I am confident they'll be benefited from this site.

my web site exercises for vertical jump

Anonymous,  May 5, 2013 at 2:52 AM  

Keep on writing, great job!

Here is my page :: Forcutie.com

Anonymous,  May 7, 2013 at 1:31 AM  

If you wish for to improve your know-how simply keep visiting
this web page and be updated with the most up-to-date gossip posted here.


Also visit my blog: vertical leap workouts

Anonymous,  May 7, 2013 at 5:16 AM  

Currently it appears like Drupal is the preferred blogging platform
out there right now. (from what I've read) Is that what you're using on your blog?


Here is my page - workouts to improve vertical

Anonymous,  May 7, 2013 at 4:41 PM  

This is the right website for anybody who wants to understand this topic.
You realize a whole lot its almost tough to argue with
you (not that I really would want to…HaHa). You definitely put a brand new spin on a subject that's been written about for many years. Wonderful stuff, just excellent!

My blog post - Workouts to increase vertical

Anonymous,  May 10, 2013 at 4:20 AM  

Hurrah, that's what I was exploring for, what a data! existing here at this blog, thanks admin of this web page.

Check out my blog :: exercises for vertical jump

Anonymous,  May 11, 2013 at 12:40 PM  

Very rapidly this web page will be famous among all blogging people, due to it's pleasant articles or reviews

my web-site - find out more

Anonymous,  May 13, 2013 at 11:40 PM  

I constantly spent my half an hour to read this weblog's posts all the time along with a mug of coffee.

My blog post ... 130.63.110.168

Anonymous,  May 20, 2013 at 1:36 PM  

I am curious to find out what blog system you have been working with?
I'm having some small security issues with my latest site and I would like to find something more risk-free. Do you have any suggestions?

Here is my page: exercises to improve vertical

Anonymous,  May 21, 2013 at 3:39 AM  

Everything is very open with a clear explanation of
the challenges. It was definitely informative. Your website is very
useful. Thanks for sharing!

My web site Project Management Certification

Anonymous,  May 21, 2013 at 10:46 AM  

You need to be a part of a contest for one
of the greatest sites on the net. I am going to recommend this site!



Also visit my web page jump higher

Anonymous,  May 21, 2013 at 11:49 AM  

I’m not that much of a internet reader to be
honest but your blogs really nice, keep it up!
I'll go ahead and bookmark your site to come back in the future. All the best

Feel free to surf to my web page :: livingwaychristianfriendshipgroup.com

Anonymous,  May 21, 2013 at 9:58 PM  

Remarkable things here. I'm very glad to look your article. Thank you a lot and I'm having a look forward to contact you.
Will you please drop me a mail?

Feel free to surf to my blog :: Exercises for vertical

Anonymous,  May 26, 2013 at 1:32 AM  

Hmm it seems like your website ate my first comment (it was super long) so I guess
I'll just sum it up what I had written and say, I'm
thoroughly enjoying your blog. I too am an aspiring blog
writer but I'm still new to everything. Do you have any suggestions for newbie blog writers? I'd genuinely appreciate it.


Here is my blog: workouts to improve vertical jump

Post a Comment

About This Blog

Healing with Foods suggests nutritious foods that may be able to help with certain health problems. Healing with Foods does not give medical advice. If you have a medical concern, please consult your doctor.

Privacy Policy

  • Google, as a third party vendor, uses cookies to serve ads on this site.
  • Google's use of the DART cookie enables it and its partners to serve ads to this site's users based on their visit to your sites and/or other sites on the Internet.
  • Users may opt out of the use of the DART cookie by visiting the Google ad and content network privacy policy.

  © Blogger templates The Professional Template by Ourblogtemplates.com 2008

Back to TOP